SCOPe 2.08: Domain d3ijea4: 3ije A:738-967

Lineage for d3ijea4 (3ije A:738-967)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.15: Integrin domains [69179] (2 families)

5. Family b.1.15.0: automated matches [233856] (1 protein)
   not a true family

6. Protein automated matches [233857] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries)

8. Domain d3ijea4: 3ije A:738-967 [246919]
   Other proteins in same PDB: d3ijea1
   automated match to d1m1xa3
   complexed with ca, nag

Details for d3ijea4

PDB Entry: 3ije, 2.9 Å

PDB Description: crystal structure of the complete integrin alhavbeta3 ectodomain plus an alpha/beta transmembrane fragment

PDB Compounds: (A:) Integrin alpha-V

SCOPe Domain Sequences for d3ijea4:

Sequence, based on SEQRES records:

>d3ijea4 b.1.15.0 (A:738-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikisslqttekndtvagqgerdhli
tkrdlalsegdihtlgcgvaqclkivcqvgrldrgksailyvksllwtetfmnkenqnhs
yslkssasfnviefpyknlpieditnstlvttnvtwgiqpapmpvpvwvi

Sequence, based on observed residues (ATOM records):

>d3ijea4 b.1.15.0 (A:738-967) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vlaaveirgvsspdhvflpipnwehkenpeteedvgpvvqhiyelrnngpssfskamlhl
qwpykynnntllyilhydidgpmnctsdmeinplrikissldihtlgcgvaqclkivcqv
grldrgksailyvksllwtetfmnkenqnhsyslkssasfnviefpyknlpieditnstl
vttnvtwgiqpapmpvpvwvi

Timeline for d3ijea4:

• d3ijea4 first appeared in SCOPe 2.04
  
• d3ijea4 appears in SCOPe 2.07