![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.15: Integrin domains [69179] (2 families) ![]() |
![]() | Family b.1.15.0: automated matches [233856] (1 protein) not a true family |
![]() | Protein automated matches [233857] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [233858] (16 PDB entries) |
![]() | Domain d3ijea2: 3ije A:439-598 [246917] Other proteins in same PDB: d3ijea1 automated match to d1m1xa1 complexed with ca, nag |
PDB Entry: 3ije (more details), 2.9 Å
SCOPe Domain Sequences for d3ijea2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ijea2 b.1.15.0 (A:439-598) automated matches {Human (Homo sapiens) [TaxId: 9606]} pvitvnaglevypsilnqdnktcslpgtalkvscfnvrfclkadgkgvlprklnfqvell ldklkqkgairralflysrspshsknmtisrgglmqceeliaylrdesefrdkltpitif meyrldyrtaadttglqpilnqftpanisrqahilldcge
Timeline for d3ijea2: