Lineage for d3i6eh2 (3i6e H:133-375)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837757Species Ruegeria pomeroyi [TaxId:89184] [255879] (1 PDB entry)
  8. 2837765Domain d3i6eh2: 3i6e H:133-375 [246742]
    Other proteins in same PDB: d3i6ea1, d3i6eb1, d3i6ec1, d3i6ed1, d3i6ee1, d3i6ef1, d3i6eg1, d3i6eh1
    automated match to d3i6ta2
    complexed with mg, na

Details for d3i6eh2

PDB Entry: 3i6e (more details), 1.7 Å

PDB Description: crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
PDB Compounds: (H:) Muconate cycloisomerase I

SCOPe Domain Sequences for d3i6eh2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i6eh2 c.1.11.0 (H:133-375) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
kcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpe
frvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesv
ygpedmvraahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlag
thmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehya
vrr

SCOPe Domain Coordinates for d3i6eh2:

Click to download the PDB-style file with coordinates for d3i6eh2.
(The format of our PDB-style files is described here.)

Timeline for d3i6eh2: