PDB entry 3i6e

View 3i6e on RCSB PDB site
Description: CRYSTAL STRUCTURE OF MUCONATE LACTONIZING ENZYME FROM Ruegeria pomeroyi.
Class: isomerase
Keywords: Structural genomics, NYSGXRC, targer 9468a, MUCONATE LACTONIZING ENZYME, PSI-2, Protein Structure Initiative, New York SGX Research Center for Structural Genomics, Isomerase
Deposited on 2009-07-07, released 2009-07-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2010-02-09, with a file datestamp of 2010-02-05.
Experiment type: XRAY
Resolution: 1.7 Å
R-factor: 0.235
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ea1, d3i6ea2
  • Chain 'B':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6eb1, d3i6eb2
  • Chain 'C':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ec1, d3i6ec2
  • Chain 'D':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ed1, d3i6ed2
  • Chain 'E':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ee1, d3i6ee2
  • Chain 'F':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6ef1, d3i6ef2
  • Chain 'G':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6eg1, d3i6eg2
  • Chain 'H':
    Compound: Muconate cycloisomerase I
    Species: Ruegeria pomeroyi [TaxId:89184]
    Gene: catB, SPO3667
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3i6eh1, d3i6eh2
  • Heterogens: MG, NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3i6eA (A:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eA (A:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3i6eB (B:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eB (B:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >3i6eC (C:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eC (C:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >3i6eD (D:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eD (D:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >3i6eE (E:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eE (E:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >3i6eF (F:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eF (F:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >3i6eG (G:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eG (G:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >3i6eH (H:)
    mslgdleqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwa
    vftgtpeasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagr
    isnlpvwallggkcrdtiplscsianpdfdadialmerlradgvgliklktgfrdhafdi
    mrleliardfpefrvrvdynqgleideavprvldvaqfqpdfieqpvrahhfelmarlrg
    ltdvplladesvygpedmvraahegicdgvsikimksggltraqtvariaaahglmaygg
    dmfeaglahlagthmiaatpeitlgcefyqasyflnediletpfrveagqvivpdgpglg
    aradpeklehyavrrsgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >3i6eH (H:)
    leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
    lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallggkcrdtip
    lscsianpdfdadialmerlradgvgliklktgfrdhafdimrleliardfpefrvrvdy
    nqgleideavprvldvaqfqpdfieqpvrahhfelmarlrgltdvplladesvygpedmv
    raahegicdgvsikimksggltraqtvariaaahglmayggdmfeaglahlagthmiaat
    peitlgcefyqasyflnediletpfrveagqvivpdgpglgaradpeklehyavrr