SCOPe 2.08: Domain d3i6ef1: 3i6e F:6-132

Lineage for d3i6ef1 (3i6e F:6-132)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Ruegeria pomeroyi [TaxId:89184] [255878] (1 PDB entry)

8. Domain d3i6ef1: 3i6e F:6-132 [246737]
   Other proteins in same PDB: d3i6ea2, d3i6eb2, d3i6ec2, d3i6ed2, d3i6ee2, d3i6ef2, d3i6eg2, d3i6eh2
   automated match to d3i6ta1
   complexed with mg, na

Details for d3i6ef1

PDB Entry: 3i6e, 1.7 Å

PDB Description: crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.

PDB Compounds: (F:) Muconate cycloisomerase I

SCOPe Domain Sequences for d3i6ef1:

Sequence, based on SEQRES records:

>d3i6ef1 d.54.1.0 (F:6-132) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
leqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwavftgt
peasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlp
vwallgg

Sequence, based on observed residues (ATOM records):

>d3i6ef1 d.54.1.0 (F:6-132) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallgg

Timeline for d3i6ef1:

• d3i6ef1 first appeared in SCOPe 2.04
  
• d3i6ef1 appears in SCOPe 2.07