Lineage for d3i6eh1 (3i6e H:6-132)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2947581Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2947582Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2947878Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 2947879Protein automated matches [226922] (95 species)
    not a true protein
  7. 2948527Species Ruegeria pomeroyi [TaxId:89184] [255878] (1 PDB entry)
  8. 2948535Domain d3i6eh1: 3i6e H:6-132 [246741]
    Other proteins in same PDB: d3i6ea2, d3i6eb2, d3i6ec2, d3i6ed2, d3i6ee2, d3i6ef2, d3i6eg2, d3i6eh2
    automated match to d3i6ta1
    complexed with mg, na

Details for d3i6eh1

PDB Entry: 3i6e (more details), 1.7 Å

PDB Description: crystal structure of muconate lactonizing enzyme from ruegeria pomeroyi.
PDB Compounds: (H:) Muconate cycloisomerase I

SCOPe Domain Sequences for d3i6eh1:

Sequence, based on SEQRES records: (download)

>d3i6eh1 d.54.1.0 (H:6-132) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
leqkiiamdlwhlalpvvsardhgigrvegsceivvlrlvaeggaegfgeaspwavftgt
peasyaaldrylrplvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlp
vwallgg

Sequence, based on observed residues (ATOM records): (download)

>d3i6eh1 d.54.1.0 (H:6-132) automated matches {Ruegeria pomeroyi [TaxId: 89184]}
leqkiiamdlwhlalpvceivvlrlvaeggaegfgeaspwavftgtpeasyaaldrylrp
lvigrrvgdrvaimdeaaravahcteakaaldsalldlagrisnlpvwallgg

SCOPe Domain Coordinates for d3i6eh1:

Click to download the PDB-style file with coordinates for d3i6eh1.
(The format of our PDB-style files is described here.)

Timeline for d3i6eh1: