SCOPe Funding Alert: SCOPe support from the NIH ended in April 2016. John-Marc Chandonia is the primary maintainer and has continued to develop SCOPe using vacation time. Three proposals to the NIH for continued funding have been unsuccessful. If our current NIH proposal is not funded, SCOPe will shut down permanently in Summer 2017 as Dr. Chandonia will need to seek a new position.

Lineage for d3i5sc_ (3i5s C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2045654Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2045783Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2045784Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2046151Protein automated matches [190043] (6 species)
    not a true protein
  7. 2046175Species Human (Homo sapiens) [TaxId:9606] [187799] (24 PDB entries)
  8. 2046197Domain d3i5sc_: 3i5s C: [246723]
    automated match to d1pnja_
    complexed with so4

Details for d3i5sc_

PDB Entry: 3i5s (more details), 3 Å

PDB Description: Crystal structure of PI3K SH3
PDB Compounds: (C:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d3i5sc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i5sc_ b.34.2.1 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett
gergdfpgtyveyigrk

SCOPe Domain Coordinates for d3i5sc_:

Click to download the PDB-style file with coordinates for d3i5sc_.
(The format of our PDB-style files is described here.)

Timeline for d3i5sc_: