Lineage for d3i5sa_ (3i5s A:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2376890Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2377019Superfamily b.34.2: SH3-domain [50044] (2 families) (S)
  5. 2377020Family b.34.2.1: SH3-domain [50045] (40 protein domains)
  6. 2377400Protein automated matches [190043] (6 species)
    not a true protein
  7. 2377424Species Human (Homo sapiens) [TaxId:9606] [187799] (31 PDB entries)
  8. 2377454Domain d3i5sa_: 3i5s A: [246721]
    automated match to d1pnja_
    complexed with so4

Details for d3i5sa_

PDB Entry: 3i5s (more details), 3 Å

PDB Description: Crystal structure of PI3K SH3
PDB Compounds: (A:) Phosphatidylinositol 3-kinase regulatory subunit alpha

SCOPe Domain Sequences for d3i5sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3i5sa_ b.34.2.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
egyqyralydykkereedidlhlgdiltvnkgslvalgfsdgqearpeeigwlngynett
gergdfpgtyveyigrk

SCOPe Domain Coordinates for d3i5sa_:

Click to download the PDB-style file with coordinates for d3i5sa_.
(The format of our PDB-style files is described here.)

Timeline for d3i5sa_: