Lineage for d3gslb1 (3gsl B:61-153)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2785883Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2785884Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2785885Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2786234Protein automated matches [190055] (6 species)
    not a true protein
  7. 2786359Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)
  8. 2786365Domain d3gslb1: 3gsl B:61-153 [246355]
    Other proteins in same PDB: d3gsla3
    automated match to d4h11a_

Details for d3gslb1

PDB Entry: 3gsl (more details), 2.05 Å

PDB Description: Crystal structure of PSD-95 tandem PDZ domains 1 and 2
PDB Compounds: (B:) Disks large homolog 4

SCOPe Domain Sequences for d3gslb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gslb1 b.36.1.1 (B:61-153) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
meyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfv
nevdvrevthsaavealkeagsivrlyvmrrkp

SCOPe Domain Coordinates for d3gslb1:

Click to download the PDB-style file with coordinates for d3gslb1.
(The format of our PDB-style files is described here.)

Timeline for d3gslb1: