PDB entry 3gsl

View 3gsl on RCSB PDB site
Description: Crystal structure of PSD-95 tandem PDZ domains 1 and 2
Class: structural protein
Keywords: PDZ domain, tandem, PSD-95, DLG4, SAP-90, GluR6, Cell junction, Cell membrane, Lipoprotein, Membrane, Palmitate, Phosphoprotein, Postsynaptic cell membrane, SH3 domain, Synapse, STRUCTURAL PROTEIN
Deposited on 2009-03-27, released 2010-09-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-02-02, with a file datestamp of 2011-01-28.
Experiment type: XRAY
Resolution: 2.05 Å
R-factor: 0.221
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Disks large homolog 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dlg4, Dlgh4, PSD-95, Psd95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (3-191)
      • expression tag (2)
      • see remark 999 (192-195)
    Domains in SCOPe 2.07: d3gsla1, d3gsla2, d3gsla3
  • Chain 'B':
    Compound: Disks large homolog 4
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Dlg4, Dlgh4, PSD-95, Psd95
    Database cross-references and differences (RAF-indexed):
    • Uniprot P31016 (3-191)
      • see remark 999 (192-195)
    Domains in SCOPe 2.07: d3gslb1, d3gslb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3gslA (A:)
    sgsmeyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsi
    lfvnevdvrevthsaavealkeagsivrlyvmrrkppaekvmeiklikgpkglgfsiagg
    vgnqhipgdnsiyvtkiieggaahkdgrlqigdkilavnsvgledvmhedavaalkntyd
    vvylkvakpsnaetma
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gslA (A:)
    smeyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilf
    vnevdvrevthsaavealkeagsivrlyvmrrkppaekvmeiklikgpkglgfsiaggvg
    nqhipgdnsiyvtkiieggaahkdgrlqigdkilavnsvgledvmhedavaalkntydvv
    ylkvakpsnaetma
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3gslB (B:)
    sgsmeyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsi
    lfvnevdvrevthsaavealkeagsivrlyvmrrkppaekvmeiklikgpkglgfsiagg
    vgnqhipgdnsiyvtkiieggaahkdgrlqigdkilavnsvgledvmhedavaalkntyd
    vvylkvakpsnaetma
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gslB (B:)
    meyeeitlergnsglgfsiaggtdnphigddpsifitkiipggaaaqdgrlrvndsilfv
    nevdvrevthsaavealkeagsivrlyvmrrkppaekvmeiklikgpkglgfsiaggvgn
    qhipgdnsiyvtkiieggaahkdgrlqigdkilavnsvgledvmhedavaalkntydvvy
    lkvakpsnaetma