SCOPe 2.07: Domain d3gsla2: 3gsl A:154-253

Lineage for d3gsla2 (3gsl A:154-253)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.1: PDZ domain [50157] (47 proteins)
   Pfam PF00595

6. Protein automated matches [190055] (6 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (10 PDB entries)

8. Domain d3gsla2: 3gsl A:154-253 [246354]
   Other proteins in same PDB: d3gsla3
   automated match to d4h11a_

Details for d3gsla2

PDB Entry: 3gsl, 2.05 Å

PDB Description: Crystal structure of PSD-95 tandem PDZ domains 1 and 2

PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d3gsla2:

Sequence; same for both SEQRES and ATOM records:

>d3gsla2 b.36.1.1 (A:154-253) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
paekvmeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgrlqigdkil
avnsvgledvmhedavaalkntydvvylkvakpsnaetma

Timeline for d3gsla2:

• d3gsla2 first appeared in SCOPe 2.04
  
• d3gsla2 appears in SCOPe 2.06
  
• d3gsla2 appears in the current release, SCOPe 2.08