Lineage for d3gsla2 (3gsl A:154-253)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2056344Fold b.36: PDZ domain-like [50155] (1 superfamily)
    contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix
  4. 2056345Superfamily b.36.1: PDZ domain-like [50156] (7 families) (S)
    peptide-binding domain
  5. 2056346Family b.36.1.1: PDZ domain [50157] (47 proteins)
    Pfam PF00595
  6. 2056646Protein automated matches [190055] (7 species)
    not a true protein
  7. 2056746Species Norway rat (Rattus norvegicus) [TaxId:10116] [186775] (11 PDB entries)
  8. 2056757Domain d3gsla2: 3gsl A:154-253 [246354]
    Other proteins in same PDB: d3gsla3
    automated match to d4h11a_

Details for d3gsla2

PDB Entry: 3gsl (more details), 2.05 Å

PDB Description: Crystal structure of PSD-95 tandem PDZ domains 1 and 2
PDB Compounds: (A:) Disks large homolog 4

SCOPe Domain Sequences for d3gsla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gsla2 b.36.1.1 (A:154-253) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
paekvmeiklikgpkglgfsiaggvgnqhipgdnsiyvtkiieggaahkdgrlqigdkil
avnsvgledvmhedavaalkntydvvylkvakpsnaetma

SCOPe Domain Coordinates for d3gsla2:

Click to download the PDB-style file with coordinates for d3gsla2.
(The format of our PDB-style files is described here.)

Timeline for d3gsla2: