Lineage for d1c0ma1 (1c0m A:217-269)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2782725Fold b.34: SH3-like barrel [50036] (21 superfamilies)
    barrel, partly opened; n*=4, S*=8; meander
    the last strand is interrupted by a turn of 3-10 helix
  4. 2784433Superfamily b.34.7: DNA-binding domain of retroviral integrase [50122] (2 families) (S)
  5. 2784434Family b.34.7.1: DNA-binding domain of retroviral integrase [50123] (1 protein)
    Pfam PF00552, Pfam PF18103
  6. 2784435Protein DNA-binding domain of retroviral integrase [50124] (4 species)
  7. 2784459Species Rous sarcoma virus RSV [TaxId:11886] [50126] (2 PDB entries)
  8. 2784460Domain d1c0ma1: 1c0m A:217-269 [24635]
    Other proteins in same PDB: d1c0ma2, d1c0mb2, d1c0mc2, d1c0md2

Details for d1c0ma1

PDB Entry: 1c0m (more details), 2.53 Å

PDB Description: crystal structure of rsv two-domain integrase
PDB Compounds: (A:) protein (integrase)

SCOPe Domain Sequences for d1c0ma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1c0ma1 b.34.7.1 (A:217-269) DNA-binding domain of retroviral integrase {Rous sarcoma virus RSV [TaxId: 11886]}
vltegppvkirietgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi

SCOPe Domain Coordinates for d1c0ma1:

Click to download the PDB-style file with coordinates for d1c0ma1.
(The format of our PDB-style files is described here.)

Timeline for d1c0ma1: