PDB entry 1c0m

View 1c0m on RCSB PDB site
Description: crystal structure of rsv two-domain integrase
Class: transferase
Keywords: integrase, rous sarcoma virus, hiv, x-ray crystallography, protein structure, transferase
Deposited on 1999-07-16, released 2000-03-01
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.53 Å
R-factor: 0.216
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (integrase)
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (0-End)
      • mutation (150)
    Domains in SCOPe 2.07: d1c0ma1, d1c0ma2
  • Chain 'B':
    Compound: protein (integrase)
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • mutation (150)
    Domains in SCOPe 2.07: d1c0mb1, d1c0mb2
  • Chain 'C':
    Compound: protein (integrase)
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354 (0-End)
      • mutation (150)
    Domains in SCOPe 2.07: d1c0mc1, d1c0mc2
  • Chain 'D':
    Compound: protein (integrase)
    Species: Rous sarcoma virus [TaxId:11886]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03354
      • mutation (150)
    Domains in SCOPe 2.07: d1c0md1, d1c0md2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1c0mA (A:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpditqkdevtkkdeasplfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0mA (A:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1c0mB (B:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpditqkdevtkkdeasplfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0mB (B:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaeg
    dgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgew
    ekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1c0mC (C:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpditqkdevtkkdeasplfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0mC (C:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdit
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1c0mD (D:)
    gvnprglgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwata
    iavlgrpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrir
    vlaegdgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkiri
    etgewekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpditqkdevtkkdeasplfa
    

    Sequence, based on observed residues (ATOM records): (download)
    >1c0mD (D:)
    glgplqiwqtdftleprmaprswlavtvdtassaivvtqhgrvtsvavqhhwataiavlg
    rpkaiktdngscftskstrewlarwgiahttgipgnsqgqamveranrllkdrirvlaeg
    dgfmkriptskqgellakamyalnhkergentktpiqkhwrptvltegppvkirietgew
    ekgwnvlvwgrgyaavknrdtdkviwvpsrkvkpdi