Lineage for d3gouc_ (3gou C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2299347Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 2299348Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 2299432Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 2299707Protein Hemoglobin, alpha-chain [46486] (24 species)
  7. 2299773Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries)
  8. 2299777Domain d3gouc_: 3gou C: [246331]
    Other proteins in same PDB: d3goub_, d3goud_
    automated match to d3pela_
    complexed with hem

Details for d3gouc_

PDB Entry: 3gou (more details), 3 Å

PDB Description: Crystal structure of dog (Canis familiaris) hemoglobin
PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gouc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3gouc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr

SCOPe Domain Coordinates for d3gouc_:

Click to download the PDB-style file with coordinates for d3gouc_.
(The format of our PDB-style files is described here.)

Timeline for d3gouc_: