SCOPe 2.06: Domain d3gouc_: 3gou C:

Lineage for d3gouc_ (3gou C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, alpha-chain [46486] (24 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries)

8. Domain d3gouc_: 3gou C: [246331]
   Other proteins in same PDB: d3goub_, d3goud_
   automated match to d3pela_
   complexed with hem

Details for d3gouc_

PDB Entry: 3gou, 3 Å

PDB Description: Crystal structure of dog (Canis familiaris) hemoglobin

PDB Compounds: (C:) Hemoglobin subunit alpha

SCOPe Domain Sequences for d3gouc_:

Sequence; same for both SEQRES and ATOM records:

>d3gouc_ a.1.1.2 (C:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]}
vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk
kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa
vhasldkffaavstvltskyr

Timeline for d3gouc_:

• d3gouc_ first appeared in SCOPe 2.04
  
• d3gouc_ appears in SCOPe 2.05
  
• d3gouc_ appears in SCOPe 2.07
  
• d3gouc_ appears in the current release, SCOPe 2.08