SCOPe 2.06: Domain d3goud_: 3gou D:

Lineage for d3goud_ (3gou D:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein Hemoglobin, beta-chain [46500] (25 species)

7. Species Dog (Canis familiaris) [TaxId:9615] [158218] (3 PDB entries)

8. Domain d3goud_: 3gou D: [246332]
   Other proteins in same PDB: d3goua_, d3gouc_
   automated match to d3pelb_
   complexed with hem

Details for d3goud_

PDB Entry: 3gou, 3 Å

PDB Description: Crystal structure of dog (Canis familiaris) hemoglobin

PDB Compounds: (D:) Hemoglobin subunit beta

SCOPe Domain Sequences for d3goud_:

Sequence; same for both SEQRES and ATOM records:

>d3goud_ a.1.1.2 (D:) Hemoglobin, beta-chain {Dog (Canis familiaris) [TaxId: 9615]}
vhltaeekslvsglwgkvnvdevggealgrllivypwtqrffdsfgdlstpdavmsnakv
kahgkkvlnsfsdglknldnlkgtfaklselhcdklhvdpenfkllgnvlvcvlahhfgk
eftpqvqaayqkvvagvanalahkyh

Timeline for d3goud_:

• d3goud_ first appeared in SCOPe 2.04
  
• d3goud_ appears in SCOPe 2.05
  
• d3goud_ appears in SCOPe 2.07
  
• d3goud_ appears in the current release, SCOPe 2.08