![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.1: Globin-like [46457] (2 superfamilies) core: 6 helices; folded leaf, partly opened |
![]() | Superfamily a.1.1: Globin-like [46458] (5 families) ![]() |
![]() | Family a.1.1.2: Globins [46463] (27 proteins) Heme-binding protein |
![]() | Protein Hemoglobin, alpha-chain [46486] (24 species) |
![]() | Species Dog (Canis familiaris) [TaxId:9615] [189534] (3 PDB entries) |
![]() | Domain d3goua_: 3gou A: [246329] Other proteins in same PDB: d3goub_, d3goud_ automated match to d3pela_ complexed with hem |
PDB Entry: 3gou (more details), 3 Å
SCOPe Domain Sequences for d3goua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3goua_ a.1.1.2 (A:) Hemoglobin, alpha-chain {Dog (Canis familiaris) [TaxId: 9615]} vlspadktnikstwdkigghagdyggealdrtfqsfpttktyfphfdlspgsaqvkahgk kvadalttavahlddlpgalsalsdlhayklrvdpvnfkllshcllvtlachhpteftpa vhasldkffaavstvltskyr
Timeline for d3goua_: