Lineage for d3gisz1 (3gis Z:350-387)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2257050Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 2258094Superfamily g.3.11: EGF/Laminin [57196] (8 families) (S)
  5. 2258773Family g.3.11.0: automated matches [227227] (1 protein)
    not a true family
  6. 2258774Protein automated matches [226968] (4 species)
    not a true protein
  7. 2258775Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)
  8. 2258800Domain d3gisz1: 3gis Z:350-387 [246322]
    automated match to d1dx5i1
    complexed with ca, so4

Details for d3gisz1

PDB Entry: 3gis (more details), 2.4 Å

PDB Description: crystal structure of na-free thrombin in complex with thrombomodulin
PDB Compounds: (Z:) thrombomodulin

SCOPe Domain Sequences for d3gisz1:

Sequence, based on SEQRES records: (download)

>d3gisz1 g.3.11.0 (Z:350-387) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcfranceyqcqplnqtsylcvcaegfapiphephrcq

Sequence, based on observed residues (ATOM records): (download)

>d3gisz1 g.3.11.0 (Z:350-387) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcfranceyqcqplnqtsylcvcaegfapipphrcq

SCOPe Domain Coordinates for d3gisz1:

Click to download the PDB-style file with coordinates for d3gisz1.
(The format of our PDB-style files is described here.)

Timeline for d3gisz1: