SCOPe 2.06: Domain d3gisz1: 3gis Z:350-387

Lineage for d3gisz1 (3gis Z:350-387)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
   disulfide-bound fold; contains beta-hairpin with two adjacent disulfides

4. Superfamily g.3.11: EGF/Laminin [57196] (8 families)

5. Family g.3.11.0: automated matches [227227] (1 protein)
   not a true family

6. Protein automated matches [226968] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries)

8. Domain d3gisz1: 3gis Z:350-387 [246322]
   automated match to d1dx5i1
   complexed with ca, so4

Details for d3gisz1

PDB Entry: 3gis, 2.4 Å

PDB Description: crystal structure of na-free thrombin in complex with thrombomodulin

PDB Compounds: (Z:) thrombomodulin

SCOPe Domain Sequences for d3gisz1:

Sequence, based on SEQRES records:

>d3gisz1 g.3.11.0 (Z:350-387) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcfranceyqcqplnqtsylcvcaegfapiphephrcq

Sequence, based on observed residues (ATOM records):

>d3gisz1 g.3.11.0 (Z:350-387) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pcfranceyqcqplnqtsylcvcaegfapipphrcq

Timeline for d3gisz1:

• d3gisz1 first appeared in SCOPe 2.04
  
• d3gisz1 appears in SCOPe 2.05
  
• d3gisz1 appears in SCOPe 2.07
  
• d3gisz1 appears in the current release, SCOPe 2.08