Class g: Small proteins [56992] (94 folds) |
Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies) disulfide-bound fold; contains beta-hairpin with two adjacent disulfides |
Superfamily g.3.11: EGF/Laminin [57196] (8 families) |
Family g.3.11.0: automated matches [227227] (1 protein) not a true family |
Protein automated matches [226968] (4 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [225423] (29 PDB entries) |
Domain d3gisy1: 3gis Y:348-387 [246319] automated match to d1dx5i1 complexed with ca, so4 |
PDB Entry: 3gis (more details), 2.4 Å
SCOPe Domain Sequences for d3gisy1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3gisy1 g.3.11.0 (Y:348-387) automated matches {Human (Homo sapiens) [TaxId: 9606]} vdpcfranceyqcqplnqtsylcvcaegfapiphephrcq
Timeline for d3gisy1: