PDB entry 3gis

View 3gis on RCSB PDB site
Description: Crystal Structure of Na-free Thrombin in Complex with Thrombomodulin
Class: blood clotting
Keywords: protein-protein complex, coagulation, Acute phase, Blood coagulation, Calcium, Cleavage on pair of basic residues, Disease mutation, Disulfide bond, Gamma-carboxyglutamic acid, Glycoprotein, Hydrolase, Kringle, Pharmaceutical, Polymorphism, Protease, Secreted, Serine protease, Zymogen, EGF-like domain, Hydroxylation, Membrane, Receptor, Thrombophilia, Transmembrane, BLOOD CLOTTING
Deposited on 2009-03-06, released 2009-08-18
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-10-06, with a file datestamp of 2009-10-02.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.211
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-258)
      • engineered (204)
  • Chain 'C':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered (204)
  • Chain 'E':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
  • Chain 'F':
    Compound: Prothrombin
    Species: Homo sapiens [TaxId:9606]
    Gene: F2
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00734 (0-End)
      • engineered (204)
  • Chain 'X':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: THBD, THRM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204
      • engineered (43)
      • engineered (111-112)
    Domains in SCOPe 2.06: d3gisx1, d3gisx2, d3gisx3
  • Chain 'Y':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: THBD, THRM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204
      • engineered (43)
      • engineered (111-112)
    Domains in SCOPe 2.06: d3gisy1, d3gisy2, d3gisy3
  • Chain 'Z':
    Compound: thrombomodulin
    Species: Homo sapiens [TaxId:9606]
    Gene: THBD, THRM
    Database cross-references and differences (RAF-indexed):
    • Uniprot P07204
      • engineered (43)
      • engineered (111-112)
    Domains in SCOPe 2.06: d3gisz1, d3gisz2, d3gisz3
  • Heterogens: SO4, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    No sequence available.

  • Chain 'B':
    No sequence available.

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.

  • Chain 'E':
    No sequence available.

  • Chain 'F':
    No sequence available.

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >3gisX (X:)
    vepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqlfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdcds
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gisX (X:)
    dpcfranceyqcqplnqtsylcvcaegfapiphephrcqlfcnqtacpadcdpnascecp
    egyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdcd
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >3gisY (Y:)
    vepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqlfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdcds
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gisY (Y:)
    vdpcfranceyqcqplnqtsylcvcaegfapiphephrcqlfcnqtacpadcdpascecp
    egyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdcd
    

  • Chain 'Z':
    Sequence, based on SEQRES records: (download)
    >3gisZ (Z:)
    vepvdpcfranceyqcqplnqtsylcvcaegfapiphephrcqlfcnqtacpadcdpntq
    ascecpegyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdcds
    g
    

    Sequence, based on observed residues (ATOM records): (download)
    >3gisZ (Z:)
    pcfranceyqcqplnqtsylcvcaegfapipphrcqlfcnqtacpadcdpntqascecpe
    gyilddgfictdidecenggfcsgvchnlpgtfecicgpdsalagqigtdcd