Lineage for d3g8ca3 (3g8c A:331-444)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2426781Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2426884Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2427009Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2427010Protein automated matches [254496] (16 species)
    not a true protein
  7. 2427023Species Escherichia coli K-12 [TaxId:83333] [255843] (2 PDB entries)
  8. 2427026Domain d3g8ca3: 3g8c A:331-444 [246262]
    Other proteins in same PDB: d3g8ca1, d3g8ca2, d3g8cb1, d3g8cb2
    automated match to d2w70a3
    complexed with adp, bct, btn, mg

Details for d3g8ca3

PDB Entry: 3g8c (more details), 2 Å

PDB Description: crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion
PDB Compounds: (A:) biotin carboxylase

SCOPe Domain Sequences for d3g8ca3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8ca3 b.84.2.0 (A:331-444) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl

SCOPe Domain Coordinates for d3g8ca3:

Click to download the PDB-style file with coordinates for d3g8ca3.
(The format of our PDB-style files is described here.)

Timeline for d3g8ca3: