|  | Class b: All beta proteins [48724] (180 folds) | 
|  | Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies) sandwich of half-barrel shaped beta-sheets | 
|  | Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families)  | 
|  | Family b.84.2.0: automated matches [254217] (1 protein) not a true family | 
|  | Protein automated matches [254496] (16 species) not a true protein | 
|  | Species Escherichia coli K-12 [TaxId:83333] [255843] (2 PDB entries) | 
|  | Domain d3g8ca3: 3g8c A:331-444 [246262] Other proteins in same PDB: d3g8ca1, d3g8ca2, d3g8cb1, d3g8cb2 automated match to d2w70a3 complexed with adp, bct, btn, mg | 
PDB Entry: 3g8c (more details), 2 Å
SCOPe Domain Sequences for d3g8ca3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3g8ca3 b.84.2.0 (A:331-444) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rghavecrinaedpntflpspgkitrfhapggfgvrweshiyagytvppyydsmigklic
ygenrdvaiarmknalqeliidgiktnvdlqirimndenfqhggtnihylekkl
Timeline for d3g8ca3: