PDB entry 3g8c

View 3g8c on RCSB PDB site
Description: Crystal Structure of Biotin Carboxylase in Complex with Biotin, Bicarbonate, ADP and Mg Ion
Class: ligase
Keywords: ATP-GRASP, CARBOXYLASE, BIOTIN-DEPENDENT, FATTY ACID SYNTHESIS, SUBSTRATES BOUND, ATP-binding, Biotin, Fatty acid biosynthesis, Ligase, Lipid synthesis, Nucleotide-binding
Deposited on 2009-02-12, released 2009-03-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-01, with a file datestamp of 2017-10-27.
Experiment type: XRAY
Resolution: 2 Å
R-factor: N/A
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:83333]
    Gene: accC, b3256, fabG, JW3224
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g8ca1, d3g8ca2, d3g8ca3
  • Chain 'B':
    Compound: biotin carboxylase
    Species: Escherichia coli [TaxId:83333]
    Gene: accC, b3256, fabG, JW3224
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d3g8cb1, d3g8cb2, d3g8cb3
  • Heterogens: ADP, MG, BTN, BCT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g8cA (A:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekkl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >3g8cB (B:)
    mldkivianrgeialrilrackelgiktvavhssadrdlkhvlladetvcigpapsvksy
    lnipaiisaaeitgavaihpgygflsenanfaeqversgfifigpkaetirlmgdkvsai
    aamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrgdaelaq
    sismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqrrhqkvv
    eeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriqvehpvt
    emitgvdlikeqlriaagqplsikqeevhvrghavecrinaedpntflpspgkitrfhap
    ggfgvrweshiyagytvppyydsmigklicygenrdvaiarmknalqeliidgiktnvdl
    qirimndenfqhggtnihylekkl