Lineage for d3g8cb2 (3g8c B:115-330)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2978554Family d.142.1.2: BC ATP-binding domain-like [56067] (7 proteins)
  6. 2978730Protein automated matches [254674] (3 species)
    not a true protein
  7. 2978731Species Escherichia coli K-12 [TaxId:83333] [255842] (2 PDB entries)
  8. 2978734Domain d3g8cb2: 3g8c B:115-330 [246264]
    Other proteins in same PDB: d3g8ca1, d3g8ca3, d3g8cb1, d3g8cb3
    automated match to d2w70a2
    complexed with adp, bct, btn, mg

Details for d3g8cb2

PDB Entry: 3g8c (more details), 2 Å

PDB Description: crystal structure of biotin carboxylase in complex with biotin, bicarbonate, adp and mg ion
PDB Compounds: (B:) biotin carboxylase

SCOPe Domain Sequences for d3g8cb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3g8cb2 d.142.1.2 (B:115-330) automated matches {Escherichia coli K-12 [TaxId: 83333]}
dkvsaiaamkkagvpcvpgsdgplgddmdknraiakrigypviikasgggggrgmrvvrg
daelaqsismtraeakaafsndmvymekylenprhveiqvladgqgnaiylaerdcsmqr
rhqkvveeapapgitpelrryigercakacvdigyrgagtfeflfengefyfiemntriq
vehpvtemitgvdlikeqlriaagqplsikqeevhv

SCOPe Domain Coordinates for d3g8cb2:

Click to download the PDB-style file with coordinates for d3g8cb2.
(The format of our PDB-style files is described here.)

Timeline for d3g8cb2: