Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [255830] (1 PDB entry) |
Domain d3fhmc1: 3fhm C:1-128 [246156] Other proteins in same PDB: d3fhma2, d3fhmc2 automated match to d4o9kb_ complexed with amp, nai, so4 |
PDB Entry: 3fhm (more details), 2.7 Å
SCOPe Domain Sequences for d3fhmc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fhmc1 d.37.1.0 (C:1-128) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} matfvkdlldrkgrdvvtvgpdvsigeaagtlhahkigavvvtdadgvvlgifterdlvk avagqgaaslqqsvsvamtknvvrcqhnsttdqlmeimtggrfrhvpveengrlagiisi gdvvkari
Timeline for d3fhmc1:
View in 3D Domains from other chains: (mouse over for more information) d3fhma1, d3fhma2, d3fhmb_, d3fhmd_ |