Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [255830] (1 PDB entry) |
Domain d3fhma1: 3fhm A:1-130 [246154] Other proteins in same PDB: d3fhma2, d3fhmc2 automated match to d4o9kb_ complexed with amp, nai, so4 |
PDB Entry: 3fhm (more details), 2.7 Å
SCOPe Domain Sequences for d3fhma1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3fhma1 d.37.1.0 (A:1-130) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} matfvkdlldrkgrdvvtvgpdvsigeaagtlhahkigavvvtdadgvvlgifterdlvk avagqgaaslqqsvsvamtknvvrcqhnsttdqlmeimtggrfrhvpveengrlagiisi gdvvkarige
Timeline for d3fhma1:
View in 3D Domains from other chains: (mouse over for more information) d3fhmb_, d3fhmc1, d3fhmc2, d3fhmd_ |