Lineage for d3fhma1 (3fhm A:1-130)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943453Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2943454Protein automated matches [191100] (15 species)
    not a true protein
  7. 2943455Species Agrobacterium tumefaciens [TaxId:176299] [255830] (1 PDB entry)
  8. 2943456Domain d3fhma1: 3fhm A:1-130 [246154]
    Other proteins in same PDB: d3fhma2, d3fhmc2
    automated match to d4o9kb_
    complexed with amp, nai, so4

Details for d3fhma1

PDB Entry: 3fhm (more details), 2.7 Å

PDB Description: Crystal structure of the CBS-domain containing protein ATU1752 from Agrobacterium tumefaciens
PDB Compounds: (A:) uncharacterized protein ATU1752

SCOPe Domain Sequences for d3fhma1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3fhma1 d.37.1.0 (A:1-130) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
matfvkdlldrkgrdvvtvgpdvsigeaagtlhahkigavvvtdadgvvlgifterdlvk
avagqgaaslqqsvsvamtknvvrcqhnsttdqlmeimtggrfrhvpveengrlagiisi
gdvvkarige

SCOPe Domain Coordinates for d3fhma1:

Click to download the PDB-style file with coordinates for d3fhma1.
(The format of our PDB-style files is described here.)

Timeline for d3fhma1: