Lineage for d4o9kb_ (4o9k B:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2943253Fold d.37: CBS-domain pair [54630] (1 superfamily)
    duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a
  4. 2943254Superfamily d.37.1: CBS-domain pair [54631] (2 families) (S)
  5. 2943453Family d.37.1.0: automated matches [191603] (1 protein)
    not a true family
  6. 2943454Protein automated matches [191100] (15 species)
    not a true protein
  7. 2943521Species Methylococcus capsulatus [TaxId:243233] [236260] (1 PDB entry)
  8. 2943523Domain d4o9kb_: 4o9k B: [236261]
    automated match to d1pbja3
    complexed with cmk, gol

Details for d4o9kb_

PDB Entry: 4o9k (more details), 1.85 Å

PDB Description: crystal structure of the cbs pair of a putative d-arabinose 5- phosphate isomerase from methylococcus capsulatus in complex with cmp-kdo
PDB Compounds: (B:) arabinose 5-phosphate isomerase

SCOPe Domain Sequences for d4o9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4o9kb_ d.37.1.0 (B:) automated matches {Methylococcus capsulatus [TaxId: 243233]}
rlltfvrdimhtgddtpvigleasvrdallemtakklgmtaivdgagtiqgvftdgdlrr
llekaqdihatpitavmtrscvtvegsllaaeavrimeqkrinalpvvengrligainmh
dllragvl

SCOPe Domain Coordinates for d4o9kb_:

Click to download the PDB-style file with coordinates for d4o9kb_.
(The format of our PDB-style files is described here.)

Timeline for d4o9kb_: