Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.37: CBS-domain pair [54630] (1 superfamily) duplication: tandem repeat of two beta-X-beta-alpha-beta(2)-alpha motifs of similar sequences; 4 layers: a/b/b/a |
Superfamily d.37.1: CBS-domain pair [54631] (2 families) |
Family d.37.1.0: automated matches [191603] (1 protein) not a true family |
Protein automated matches [191100] (15 species) not a true protein |
Species Methylococcus capsulatus [TaxId:243233] [236260] (1 PDB entry) |
Domain d4o9kb_: 4o9k B: [236261] automated match to d1pbja3 complexed with cmk, gol |
PDB Entry: 4o9k (more details), 1.85 Å
SCOPe Domain Sequences for d4o9kb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4o9kb_ d.37.1.0 (B:) automated matches {Methylococcus capsulatus [TaxId: 243233]} rlltfvrdimhtgddtpvigleasvrdallemtakklgmtaivdgagtiqgvftdgdlrr llekaqdihatpitavmtrscvtvegsllaaeavrimeqkrinalpvvengrligainmh dllragvl
Timeline for d4o9kb_: