SCOPe 2.07: Domain d3f0fb_: 3f0f B:

Lineage for d3f0fb_ (3f0f B:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
   core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest

4. Superfamily d.79.5: IpsF-like [69765] (2 families)
   forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)

5. Family d.79.5.0: automated matches [191525] (1 protein)
   not a true family

6. Protein automated matches [190884] (7 species)
   not a true protein

7. Species Burkholderia pseudomallei [TaxId:28450] [255823] (12 PDB entries)

8. Domain d3f0fb_: 3f0f B: [246004]
   automated match to d3re3a_
   complexed with c5p, gol, mg, zn

Details for d3f0fb_

PDB Entry: 3f0f, 2.09 Å

PDB Description: co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp

PDB Compounds: (B:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3f0fb_:

Sequence; same for both SEQRES and ATOM records:

>d3f0fb_ d.79.5.0 (B:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Timeline for d3f0fb_:

• d3f0fb_ first appeared in SCOPe 2.04
  
• d3f0fb_ appears in SCOPe 2.06
  
• d3f0fb_ appears in the current release, SCOPe 2.08