Lineage for d3f0fc_ (3f0f C:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2565345Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2566989Superfamily d.79.5: IpsF-like [69765] (2 families) (S)
    forms trimers with three closely packed beta-sheets; possible link between the YjgF-like (d.79.1) and 4'-phosphopantetheinyl transferase superfamilies (d.150.1)
  5. 2567130Family d.79.5.0: automated matches [191525] (1 protein)
    not a true family
  6. 2567131Protein automated matches [190884] (7 species)
    not a true protein
  7. 2567142Species Burkholderia pseudomallei [TaxId:28450] [255823] (12 PDB entries)
  8. 2567184Domain d3f0fc_: 3f0f C: [246005]
    automated match to d3re3a_
    complexed with c5p, gol, mg, zn

Details for d3f0fc_

PDB Entry: 3f0f (more details), 2.09 Å

PDB Description: co-crystal structure of 2c-methyl-d-erythritol 2,4-cyclodiphosphate synthase from burkholderia pseudomallei with hydrolyzed cdp
PDB Compounds: (C:) 2-C-methyl-D-erythritol 2,4-cyclodiphosphate synthase

SCOPe Domain Sequences for d3f0fc_:

Sequence, based on SEQRES records: (download)

>d3f0fc_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsdtdprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaa
dldlpldrvnvkaktneklgylgrgegieaqaaalvvre

Sequence, based on observed residues (ATOM records): (download)

>d3f0fc_ d.79.5.0 (C:) automated matches {Burkholderia pseudomallei [TaxId: 28450]}
mdfrigqgydvhqlvpgrpliiggvtipyergllghsdadvllhaitdalfgaaalgdig
rhfsprfkgadsrallrecasrvaqagfairnvdstiiaqapklaphidamraniaadld
lpldrvnvkaktneklgylgrgegieaqaaalvvre

SCOPe Domain Coordinates for d3f0fc_:

Click to download the PDB-style file with coordinates for d3f0fc_.
(The format of our PDB-style files is described here.)

Timeline for d3f0fc_: