![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily) folded sheet; greek-key |
![]() | Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families) ![]() this domain is C-terminal to the catalytic beta/alpha barrel domain |
![]() | Family b.71.1.0: automated matches [227134] (1 protein) not a true family |
![]() | Protein automated matches [226835] (41 species) not a true protein |
![]() | Species Flavobacterium sp. [TaxId:197856] [255817] (5 PDB entries) |
![]() | Domain d3edfb3: 3edf B:518-599 [245842] Other proteins in same PDB: d3edfa1, d3edfa2, d3edfb1, d3edfb2 automated match to d1h3ga2 complexed with ca, gol |
PDB Entry: 3edf (more details), 1.65 Å
SCOPe Domain Sequences for d3edfb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edfb3 b.71.1.0 (B:518-599) automated matches {Flavobacterium sp. [TaxId: 197856]} rlmhfgpeentwvyfrynkdkrimvamnnndkpmtlptarfqemlkgapsgvdflsgktv glgrelrlapksvvvielpglp
Timeline for d3edfb3: