PDB entry 3edf

View 3edf on RCSB PDB site
Description: Structural base for cyclodextrin hydrolysis
Class: hydrolase
Keywords: alpha-cyclodextrin complex, Glycosidase, Hydrolase
Deposited on 2008-09-03, released 2009-03-03
The last revision prior to the SCOPe 2.08 freeze date was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: N/A
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cyclomaltodextrinase
    Species: Flavobacterium sp. 92 [TaxId:197856]
    Gene: cdase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KKG0
      • engineered (48)
      • engineered (339)
    Domains in SCOPe 2.08: d3edfa1, d3edfa2, d3edfa3
  • Chain 'B':
    Compound: cyclomaltodextrinase
    Species: Flavobacterium sp. 92 [TaxId:197856]
    Gene: cdase
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8KKG0
      • engineered (48)
      • engineered (339)
    Domains in SCOPe 2.08: d3edfb1, d3edfb2, d3edfb3
  • Heterogens: CA, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >3edfA (A:)
    aaptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edfA (A:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >3edfB (B:)
    aaptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfv
    dleigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfang
    dpsndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysy
    hgyaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwi
    nyggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwi
    eyaglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfd
    gytshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdma
    rmfsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagd
    kanafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkri
    mvamnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglpe
    a
    

    Sequence, based on observed residues (ATOM records): (download)
    >3edfB (B:)
    ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
    eigpeaqpgsfdivfkgdgrseryryrllareqgsaqrqgfgpgdaiyqimpdrfangdp
    sndnvagmreqadrrhgggrhggdirgtidhldyiaglgftqlwptplvendaaaysyhg
    yaatdhyridprygsnedfvrlstearkrgmgliqdvvlshigkhhwwmkdlptpdwiny
    ggkfvptqhhrvavqdpyaaqadsenftkgwfvegmpdlnqtnplvanyliqnniwwiey
    aglsglridtygysdgaflteytrrlmaeyprlnmvgqewstrvpvvarwqrgkanfdgy
    tshlpslmdfplvdamrnalsktgeenglnevyetlsldylypepqnlvlfggnhdmarm
    fsaagedfdrwrmnlvflmtmpripqfysgdeilmtstvkgrddasyrrdfpggwagdka
    nafsgagltsqqraaqdlvrklanwrknqpvihngrlmhfgpeentwvyfrynkdkrimv
    amnnndkpmtlptarfqemlkgapsgvdflsgktvglgrelrlapksvvvielpglp