| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.18: E set domains [81296] (27 families) ![]() "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies |
| Family b.1.18.0: automated matches [191341] (1 protein) not a true family |
| Protein automated matches [190226] (81 species) not a true protein |
| Species Flavobacterium sp. [TaxId:197856] [255815] (5 PDB entries) |
| Domain d3edfb1: 3edf B:3-95 [245840] Other proteins in same PDB: d3edfa2, d3edfa3, d3edfb2, d3edfb3 automated match to d1h3ga1 complexed with ca, gol |
PDB Entry: 3edf (more details), 1.65 Å
SCOPe Domain Sequences for d3edfb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3edfb1 b.1.18.0 (B:3-95) automated matches {Flavobacterium sp. [TaxId: 197856]}
ptaiehmeppfwwagmqhkglqlmvhgrdigrmeaaldypgvrlvsptrvpnanylfvdl
eigpeaqpgsfdivfkgdgrseryryrllareq
Timeline for d3edfb1: