Lineage for d3e1f13 (3e1f 1:334-625)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2829818Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2832343Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2832344Protein automated matches [190075] (132 species)
    not a true protein
  7. 2832572Species Escherichia coli K-12 [TaxId:83333] [193700] (19 PDB entries)
  8. 2832645Domain d3e1f13: 3e1f 1:334-625 [245748]
    Other proteins in same PDB: d3e1f11, d3e1f12, d3e1f14, d3e1f15, d3e1f21, d3e1f22, d3e1f24, d3e1f25, d3e1f31, d3e1f32, d3e1f34, d3e1f35, d3e1f41, d3e1f42, d3e1f44, d3e1f45
    automated match to d1jz7a5
    complexed with dms, gal, mg, na

Details for d3e1f13

PDB Entry: 3e1f (more details), 3 Å

PDB Description: e.coli (lacz) beta-galactosidase (h418e) in complex with galactose
PDB Compounds: (1:) beta-galactosidase

SCOPe Domain Sequences for d3e1f13:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1f13 c.1.8.0 (1:334-625) automated matches {Escherichia coli K-12 [TaxId: 83333]}
evriengllllngkpllirgvnrhehhplhgqvmdeqtmvqdillmkqnnfnavrcshyp
nhplwytlcdryglyvvdeanietegmvpmnrltddprwlpamservtrmvqrdrnhpsv
iiwslgnesghganhdalyrwiksvdpsrpvqyegggadttatdiicpmyarvdedqpfp
avpkwsikkwlslpgetrplilceyahamgnslggfakywqafrqyprlqggfvwdwvdq
slikydengnpwsayggdfgdtpndrqfcmnglvfadrtphpalteakhqqq

SCOPe Domain Coordinates for d3e1f13:

Click to download the PDB-style file with coordinates for d3e1f13.
(The format of our PDB-style files is described here.)

Timeline for d3e1f13: