Lineage for d3e1f21 (3e1f 2:13-219)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2774100Fold b.18: Galactose-binding domain-like [49784] (1 superfamily)
    sandwich; 9 strands in 2 sheets; jelly-roll
  4. 2774101Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) (S)
  5. 2774971Family b.18.1.0: automated matches [191481] (1 protein)
    not a true family
  6. 2774972Protein automated matches [190770] (51 species)
    not a true protein
  7. 2775086Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries)
  8. 2775156Domain d3e1f21: 3e1f 2:13-219 [245751]
    Other proteins in same PDB: d3e1f12, d3e1f13, d3e1f14, d3e1f15, d3e1f22, d3e1f23, d3e1f24, d3e1f25, d3e1f32, d3e1f33, d3e1f34, d3e1f35, d3e1f42, d3e1f43, d3e1f44, d3e1f45
    automated match to d1f49a3
    complexed with dms, gal, mg, na

Details for d3e1f21

PDB Entry: 3e1f (more details), 3 Å

PDB Description: e.coli (lacz) beta-galactosidase (h418e) in complex with galactose
PDB Compounds: (2:) beta-galactosidase

SCOPe Domain Sequences for d3e1f21:

Sequence; same for both SEQRES and ATOM records: (download)

>d3e1f21 b.18.1.0 (2:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]}
rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes
wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes
wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws
dgsyledqdmwrmsgifrdvsllhkpt

SCOPe Domain Coordinates for d3e1f21:

Click to download the PDB-style file with coordinates for d3e1f21.
(The format of our PDB-style files is described here.)

Timeline for d3e1f21: