![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.18: Galactose-binding domain-like [49784] (1 superfamily) sandwich; 9 strands in 2 sheets; jelly-roll |
![]() | Superfamily b.18.1: Galactose-binding domain-like [49785] (35 families) ![]() |
![]() | Family b.18.1.0: automated matches [191481] (1 protein) not a true family |
![]() | Protein automated matches [190770] (51 species) not a true protein |
![]() | Species Escherichia coli K-12 [TaxId:83333] [255789] (18 PDB entries) |
![]() | Domain d3e1f41: 3e1f 4:13-219 [245761] Other proteins in same PDB: d3e1f12, d3e1f13, d3e1f14, d3e1f15, d3e1f22, d3e1f23, d3e1f24, d3e1f25, d3e1f32, d3e1f33, d3e1f34, d3e1f35, d3e1f42, d3e1f43, d3e1f44, d3e1f45 automated match to d1f49a3 complexed with dms, gal, mg, na |
PDB Entry: 3e1f (more details), 3 Å
SCOPe Domain Sequences for d3e1f41:
Sequence; same for both SEQRES and ATOM records: (download)
>d3e1f41 b.18.1.0 (4:13-219) automated matches {Escherichia coli K-12 [TaxId: 83333]} rrdwenpgvtqlnrlaahppfaswrnseeartdrpsqqlrslngewrfawfpapeavpes wlecdlpeadtvvvpsnwqmhgydapiytnvtypitvnppfvptenptgcysltfnvdes wlqegqtriifdgvnsafhlwcngrwvgygqdsrlpsefdlsaflragenrlavmvlrws dgsyledqdmwrmsgifrdvsllhkpt
Timeline for d3e1f41:
![]() Domains from same chain: (mouse over for more information) d3e1f42, d3e1f43, d3e1f44, d3e1f45 |