Lineage for d3agjc3 (3agj C:323-434)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1544753Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies)
    barrel, closed; n=6, S=10; greek-key
  4. 1544754Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) (S)
    probably related to the second domain and its superfamiy by a circular permutation
  5. 1544858Family b.44.1.0: automated matches [254194] (1 protein)
    not a true family
  6. 1544859Protein automated matches [254425] (11 species)
    not a true protein
  7. 1544863Species Aeropyrum pernix [TaxId:56636] [255748] (1 PDB entry)
  8. 1544865Domain d3agjc3: 3agj C:323-434 [245145]
    Other proteins in same PDB: d3agja1, d3agja2, d3agjc1, d3agjc2, d3agje1, d3agje2, d3agjg1, d3agjg2
    automated match to d1jnya2
    complexed with gtp, mg

Details for d3agjc3

PDB Entry: 3agj (more details), 2.3 Å

PDB Description: Crystal structure of archaeal Pelota and GTP-bound EF1 alpha complex
PDB Compounds: (C:) Elongation factor 1-alpha

SCOPe Domain Sequences for d3agjc3:

Sequence; same for both SEQRES and ATOM records: (download)

>d3agjc3 b.44.1.0 (C:323-434) automated matches {Aeropyrum pernix [TaxId: 56636]}
aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka
gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpakvdi

SCOPe Domain Coordinates for d3agjc3:

Click to download the PDB-style file with coordinates for d3agjc3.
(The format of our PDB-style files is described here.)

Timeline for d3agjc3:

  • d3agjc3 is new in SCOPe 2.04-stable
  • d3agjc3 does not appear in SCOPe 2.05