| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50466] (6 proteins) |
| Protein Elongation factor eEF-1alpha, C-terminal domain [50472] (2 species) eukaryotic and archaeal homologue of EF-Tu |
| Species Sulfolobus solfataricus [TaxId:2287] [69277] (2 PDB entries) Uniprot P35021 |
| Domain d1jnya2: 1jny A:323-429 [66983] Other proteins in same PDB: d1jnya1, d1jnya3, d1jnyb1, d1jnyb3 complexed with gdp |
PDB Entry: 1jny (more details), 1.8 Å
SCOPe Domain Sequences for d1jnya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1jnya2 b.44.1.1 (A:323-429) Elongation factor eEF-1alpha, C-terminal domain {Sulfolobus solfataricus [TaxId: 2287]}
adeftariivvwhptalangytpvlhvhtasvacrvselvskldprtgqeaeknpqflkq
gdvaivkfkpikplcvekynefpplgrfamrdmgktvgvgiivdvkp
Timeline for d1jnya2: