| Class b: All beta proteins [48724] (176 folds) |
| Fold b.44: Elongation factor/aminomethyltransferase common domain [50464] (2 superfamilies) barrel, closed; n=6, S=10; greek-key |
Superfamily b.44.1: EF-Tu/eEF-1alpha/eIF2-gamma C-terminal domain [50465] (2 families) ![]() probably related to the second domain and its superfamiy by a circular permutation |
| Family b.44.1.0: automated matches [254194] (1 protein) not a true family |
| Protein automated matches [254425] (11 species) not a true protein |
| Species Aeropyrum pernix [TaxId:56636] [255748] (1 PDB entry) |
| Domain d3agja3: 3agj A:323-435 [245142] Other proteins in same PDB: d3agja1, d3agja2, d3agjc1, d3agjc2, d3agje1, d3agje2, d3agjg1, d3agjg2 automated match to d1jnya2 complexed with gtp, mg |
PDB Entry: 3agj (more details), 2.3 Å
SCOPe Domain Sequences for d3agja3:
Sequence; same for both SEQRES and ATOM records: (download)
>d3agja3 b.44.1.0 (A:323-435) automated matches {Aeropyrum pernix [TaxId: 56636]}
aeefearifviwhpsaitvgytpvihvhtasvssriieikakldpktgqvveqnpqflka
gdaaivrfkpvkplvvekfseipqlgrfamrdmnrtvgigivtdvkpakvdik
Timeline for d3agja3: