Lineage for d3abwd_ (3abw D:)

  1. Root: SCOPe 2.08
  2. 3021034Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)
  3. 3022990Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily)
    core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane
  4. 3022991Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) (S)
    Pfam PF13853. Phylogeny described in PubMed 12761335
  5. 3023317Family f.13.1.0: automated matches [227143] (1 protein)
    not a true family
  6. 3023318Protein automated matches [226845] (25 species)
    not a true protein
  7. 3023523Species Natronomonas pharaonis [TaxId:348780] [255740] (4 PDB entries)
  8. 3023535Domain d3abwd_: 3abw D: [245082]
    automated match to d1e12a_
    complexed with 22b, azi, l3p, ret

Details for d3abwd_

PDB Entry: 3abw (more details), 1.9 Å

PDB Description: Crystal structure of pharaonis halorhodopsin in complex with azide ion
PDB Compounds: (D:) halorhodopsin

SCOPe Domain Sequences for d3abwd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3abwd_ f.13.1.0 (D:) automated matches {Natronomonas pharaonis [TaxId: 348780]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsg

SCOPe Domain Coordinates for d3abwd_:

Click to download the PDB-style file with coordinates for d3abwd_.
(The format of our PDB-style files is described here.)

Timeline for d3abwd_: