![]() | Class f: Membrane and cell surface proteins and peptides [56835] (69 folds) |
![]() | Fold f.13: Class A G protein-coupled receptor (GPCR)-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
![]() | Superfamily f.13.1: Class A G protein-coupled receptor (GPCR)-like [81321] (5 families) ![]() Pfam PF13853. Phylogeny described in PubMed 12761335 |
![]() | Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
![]() | Protein automated matches [226845] (25 species) not a true protein |
![]() | Species Natronomonas pharaonis [TaxId:348780] [255740] (4 PDB entries) |
![]() | Domain d3abwa_: 3abw A: [245080] automated match to d1e12a_ complexed with 22b, azi, l3p, ret |
PDB Entry: 3abw (more details), 1.9 Å
SCOPe Domain Sequences for d3abwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abwa_ f.13.1.0 (A:) automated matches {Natronomonas pharaonis [TaxId: 348780]} evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky ifaflllnyltsnegvvsgs
Timeline for d3abwa_: