SCOPe 2.04: Domain d3abwd_: 3abw D:

Lineage for d3abwd_ (3abw D:)

1. Root: SCOPe 2.04

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily)
   core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane

4. Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (3 families)

5. Family f.13.1.0: automated matches [227143] (1 protein)
   not a true family

6. Protein automated matches [226845] (10 species)
   not a true protein

7. Species Natronomonas pharaonis [TaxId:348780] [255740] (2 PDB entries)

8. Domain d3abwd_: 3abw D: [245082]
   automated match to d1e12a_
   complexed with 22b, azi, l3p, ret

Details for d3abwd_

PDB Entry: 3abw, 1.9 Å

PDB Description: Crystal structure of pharaonis halorhodopsin in complex with azide ion

PDB Compounds: (D:) halorhodopsin

SCOPe Domain Sequences for d3abwd_:

Sequence; same for both SEQRES and ATOM records:

>d3abwd_ f.13.1.0 (D:) automated matches {Natronomonas pharaonis [TaxId: 348780]}
evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv
siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla
lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve
waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky
ifaflllnyltsnegvvsg

Timeline for d3abwd_:

• d3abwd_ is new in SCOPe 2.04-stable
  
• d3abwd_ appears in SCOPe 2.05
  
• d3abwd_ appears in the current release, SCOPe 2.08