![]() | Class f: Membrane and cell surface proteins and peptides [56835] (57 folds) |
![]() | Fold f.13: Family A G protein-coupled receptor-like [81322] (1 superfamily) core: up-and-down bundle of seven transmembrane helices tilted 20 degrees with respect to the plane of the membrane |
![]() | Superfamily f.13.1: Family A G protein-coupled receptor-like [81321] (3 families) ![]() |
![]() | Family f.13.1.0: automated matches [227143] (1 protein) not a true family |
![]() | Protein automated matches [226845] (10 species) not a true protein |
![]() | Species Natronomonas pharaonis [TaxId:348780] [255740] (2 PDB entries) |
![]() | Domain d3abwd_: 3abw D: [245082] automated match to d1e12a_ complexed with 22b, azi, l3p, ret |
PDB Entry: 3abw (more details), 1.9 Å
SCOPe Domain Sequences for d3abwd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3abwd_ f.13.1.0 (D:) automated matches {Natronomonas pharaonis [TaxId: 348780]} evtqrelfefvlndpllasslyinialaglsillfvfmtrglddprakliavstilvpvv siasytglasgltisvlempaghfaegssvmlggeevdgvvtmwgryltwalstpmilla lgllagsnatklftaitfdiamcvtglaaalttsshlmrwfwyaiscacfivvlyillve waqdakaagtadifstlklltvvmwlgypivwalgvegvavlpvgytswaysaldivaky ifaflllnyltsnegvvsg
Timeline for d3abwd_: