Lineage for d2zdyb1 (2zdy B:21-187)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708719Superfamily a.29.5: alpha-ketoacid dehydrogenase kinase, N-terminal domain [69012] (2 families) (S)
    automatically mapped to Pfam PF10436
  5. 2708773Family a.29.5.0: automated matches [230678] (1 protein)
    not a true family
  6. 2708774Protein automated matches [230679] (2 species)
    not a true protein
  7. 2708775Species Human (Homo sapiens) [TaxId:9606] [230680] (8 PDB entries)
  8. 2708788Domain d2zdyb1: 2zdy B:21-187 [244914]
    Other proteins in same PDB: d2zdya2, d2zdya3, d2zdyb2
    automated match to d2e0ab1
    complexed with adp, epe, mg

Details for d2zdyb1

PDB Entry: 2zdy (more details), 2.4 Å

PDB Description: inhibitor-bound structures of human pyruvate dehydrogenase kinase 4
PDB Compounds: (B:) Pyruvate dehydrogenase kinase isozyme 4

SCOPe Domain Sequences for d2zdyb1:

Sequence, based on SEQRES records: (download)

>d2zdyb1 a.29.5.0 (B:21-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptqlv
ntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiie
ykdactvdpvtnqnlqyfldrfymnristrmlmnqhilifsdsqtgn

Sequence, based on observed residues (ATOM records): (download)

>d2zdyb1 a.29.5.0 (B:21-187) automated matches {Human (Homo sapiens) [TaxId: 9606]}
prevehfsryspsplsmkqlldfgsenacertsfaflrqelpvrlanilkeidilptqlv
ntssvqlvkswyiqslmdlvefhekspddqkalsdfvdtlikvrnrhhnvvptmaqgiie
ykdactvdpvtnqnlqyfldrfymnristrmlmnqhilifstgn

SCOPe Domain Coordinates for d2zdyb1:

Click to download the PDB-style file with coordinates for d2zdyb1.
(The format of our PDB-style files is described here.)

Timeline for d2zdyb1: