Lineage for d2yyab2 (2yya B:102-322)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979090Species Aquifex aeolicus [TaxId:63363] [255713] (2 PDB entries)
  8. 2979094Domain d2yyab2: 2yya B:102-322 [244886]
    Other proteins in same PDB: d2yyaa1, d2yyaa3, d2yyab1, d2yyab3
    automated match to d1gsoa3

Details for d2yyab2

PDB Entry: 2yya (more details), 2.4 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus
PDB Compounds: (B:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yyab2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yyab2 d.142.1.0 (B:102-322) automated matches {Aquifex aeolicus [TaxId: 63363]}
skafaktfmkkygiptaryevftdfekakeyvekvgapivvkadglaagkgavvcetvek
aietldrflnkkifgksservvieeflegeeasyivmingdryvplptsqdhkrlldedk
gpntggmgaysptpvineevekrireeivervikglkeegiyyrgflyaglmitkegpkv
lefnvrlgdpeaqpilmrvkndfletllnfyegkdvhiked

SCOPe Domain Coordinates for d2yyab2:

Click to download the PDB-style file with coordinates for d2yyab2.
(The format of our PDB-style files is described here.)

Timeline for d2yyab2: