Lineage for d2yyaa3 (2yya A:323-423)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2817437Fold b.84: Barrel-sandwich hybrid [51229] (5 superfamilies)
    sandwich of half-barrel shaped beta-sheets
  4. 2817540Superfamily b.84.2: Rudiment single hybrid motif [51246] (3 families) (S)
  5. 2817665Family b.84.2.0: automated matches [254217] (1 protein)
    not a true family
  6. 2817666Protein automated matches [254496] (16 species)
    not a true protein
  7. 2817667Species Aquifex aeolicus [TaxId:63363] [255714] (2 PDB entries)
  8. 2817670Domain d2yyaa3: 2yya A:323-423 [244884]
    Other proteins in same PDB: d2yyaa1, d2yyaa2, d2yyab1, d2yyab2
    automated match to d1gsoa1

Details for d2yyaa3

PDB Entry: 2yya (more details), 2.4 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yyaa3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yyaa3 b.84.2.0 (A:323-423) automated matches {Aquifex aeolicus [TaxId: 63363]}
eryaldvvlasrgypekpetgkiihgldylksmedvvvfhagtkkegnftvtsggrvlnv
caygktlkeakerayeairyvcfegmhyrkdigdkafkyls

SCOPe Domain Coordinates for d2yyaa3:

Click to download the PDB-style file with coordinates for d2yyaa3.
(The format of our PDB-style files is described here.)

Timeline for d2yyaa3: