| Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
| Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) ![]() |
| Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
| Protein automated matches [226904] (38 species) not a true protein |
| Species Aquifex aeolicus [TaxId:63363] [255713] (2 PDB entries) |
| Domain d2yyab2: 2yya B:102-322 [244886] Other proteins in same PDB: d2yyaa1, d2yyaa3, d2yyab1, d2yyab3 automated match to d1gsoa3 |
PDB Entry: 2yya (more details), 2.4 Å
SCOPe Domain Sequences for d2yyab2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yyab2 d.142.1.0 (B:102-322) automated matches {Aquifex aeolicus [TaxId: 63363]}
skafaktfmkkygiptaryevftdfekakeyvekvgapivvkadglaagkgavvcetvek
aietldrflnkkifgksservvieeflegeeasyivmingdryvplptsqdhkrlldedk
gpntggmgaysptpvineevekrireeivervikglkeegiyyrgflyaglmitkegpkv
lefnvrlgdpeaqpilmrvkndfletllnfyegkdvhiked
Timeline for d2yyab2: