Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.0: automated matches [227183] (1 protein) not a true family |
Protein automated matches [226903] (40 species) not a true protein |
Species Aquifex aeolicus [TaxId:63363] [255712] (2 PDB entries) |
Domain d2yyaa1: 2yya A:1-101 [244882] Other proteins in same PDB: d2yyaa2, d2yyaa3, d2yyab2, d2yyab3 automated match to d1gsoa2 |
PDB Entry: 2yya (more details), 2.4 Å
SCOPe Domain Sequences for d2yyaa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2yyaa1 c.30.1.0 (A:1-101) automated matches {Aquifex aeolicus [TaxId: 63363]} mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn egvdftivgpeaplvegivdefekrglkifgpnkeaakleg
Timeline for d2yyaa1: