Lineage for d2yyaa1 (2yya A:1-101)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2861871Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
    3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
    possible rudiment form of Rossmann-fold domain
  4. 2861872Superfamily c.30.1: PreATP-grasp domain [52440] (10 families) (S)
    precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function
  5. 2862338Family c.30.1.0: automated matches [227183] (1 protein)
    not a true family
  6. 2862339Protein automated matches [226903] (40 species)
    not a true protein
  7. 2862356Species Aquifex aeolicus [TaxId:63363] [255712] (2 PDB entries)
  8. 2862359Domain d2yyaa1: 2yya A:1-101 [244882]
    Other proteins in same PDB: d2yyaa2, d2yyaa3, d2yyab2, d2yyab3
    automated match to d1gsoa2

Details for d2yyaa1

PDB Entry: 2yya (more details), 2.4 Å

PDB Description: Crystal structure of GAR synthetase from Aquifex aeolicus
PDB Compounds: (A:) Phosphoribosylamine--glycine ligase

SCOPe Domain Sequences for d2yyaa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2yyaa1 c.30.1.0 (A:1-101) automated matches {Aquifex aeolicus [TaxId: 63363]}
mkvlvvgnggrehaiawkvaqsplvkelyvakgnagiweiakrvdisptdveklaefakn
egvdftivgpeaplvegivdefekrglkifgpnkeaakleg

SCOPe Domain Coordinates for d2yyaa1:

Click to download the PDB-style file with coordinates for d2yyaa1.
(The format of our PDB-style files is described here.)

Timeline for d2yyaa1: