Lineage for d2xzmm_ (2xzm M:)

  1. Root: SCOPe 2.08
  2. 3042554Class i: Low resolution protein structures [58117] (25 folds)
  3. 3042555Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 3042556Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 3044140Family i.1.1.3: Small subunit [58132] (3 proteins)
  6. 3044141Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)
  7. 3044166Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry)
  8. 3044187Domain d2xzmm_: 2xzm M: [244681]
    Other proteins in same PDB: d2xzm62, d2xzmn2
    complexed with mg, zn
    complexed with mg, zn

Details for d2xzmm_

PDB Entry: 2xzm (more details), 3.93 Å

PDB Description: crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. this file contains the 40s subunit and initiation factor for molecule 1
PDB Compounds: (M:) rps18e

SCOPe Domain Sequences for d2xzmm_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2xzmm_ i.1.1.3 (M:) Eukaryotic, cytoplasmic (40S subunit) {Tetrahymena thermophila [TaxId: 5911]}
msfviekesdfkyihrilntnidgkritpialtgirgigrrfayiickvlkidpnaragl
ltedqcnkitdliadpeahgiptwllnrindfkdgknyqmasntldtkmredlerlkkik
shrglrhfwglkvrgqhtktsgrhgvvcgvvrkn

SCOPe Domain Coordinates for d2xzmm_:

Click to download the PDB-style file with coordinates for d2xzmm_.
(The format of our PDB-style files is described here.)

Timeline for d2xzmm_: