SCOPe 2.08: Domain d2xzmn1: 2xzm N:3-53

Lineage for d2xzmn1 (2xzm N:3-53)

1. Root: SCOPe 2.08

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.3: Small subunit [58132] (3 proteins)

6. Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species)

7. Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry)

8. Domain d2xzmn1: 2xzm N:3-53 [244682]
   Other proteins in same PDB: d2xzm62, d2xzmn2
   complexed with mg, zn
   complexed with mg, zn

Details for d2xzmn1

PDB Entry: 2xzm, 3.93 Å

PDB Description: crystal structure of the eukaryotic 40s ribosomal subunit in complex with initiation factor 1. this file contains the 40s subunit and initiation factor for molecule 1

PDB Compounds: (N:) rps29e

SCOPe Domain Sequences for d2xzmn1:

Sequence; same for both SEQRES and ATOM records:

>d2xzmn1 i.1.1.3 (N:3-53) Eukaryotic, cytoplasmic (40S subunit) {Tetrahymena thermophila [TaxId: 5911]}
nklwrthprnygkdskecrvcgarqglitkyemmtcrrcfreqaphigfvk

Timeline for d2xzmn1:

• d2xzmn1 first appeared in SCOPe 2.04, called d2xzmn_
  
• d2xzmn1 appears in SCOPe 2.07