![]() | Class i: Low resolution protein structures [58117] (25 folds) |
![]() | Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
![]() | Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) ![]() |
![]() | Family i.1.1.3: Small subunit [58132] (3 proteins) |
![]() | Protein Eukaryotic, cytoplasmic (40S subunit) [254422] (2 species) |
![]() | Species Tetrahymena thermophila [TaxId:5911] [254866] (1 PDB entry) |
![]() | Domain d2xzm9_: 2xzm 9: [244669] Other proteins in same PDB: d2xzm62, d2xzmn2 complexed with mg, zn complexed with mg, zn |
PDB Entry: 2xzm (more details), 3.93 Å
SCOPe Domain Sequences for d2xzm9_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2xzm9_ i.1.1.3 (9:) Eukaryotic, cytoplasmic (40S subunit) {Tetrahymena thermophila [TaxId: 5911]} kkkkkkksyttkkktkhrhvhtklgalafyklenngkvslqqkgcpkcgpgifmakhydr hycgkchltlkidxxxxxxxxxxxxxxxxxxxxxxxxx
Timeline for d2xzm9_:
![]() Domains from other chains: (mouse over for more information) d2xzm1_, d2xzm2_, d2xzm3_, d2xzm4_, d2xzm5_, d2xzm61, d2xzm62, d2xzm7_, d2xzm8_, d2xzmb_, d2xzmc_, d2xzmd_, d2xzme_, d2xzmf_, d2xzmg_, d2xzmh_, d2xzmi_, d2xzmj_, d2xzmk_, d2xzml_, d2xzmm_, d2xzmn1, d2xzmn2, d2xzmo_, d2xzmp_, d2xzmq_, d2xzmr_, d2xzms_, d2xzmt_, d2xzmu_, d2xzmv_, d2xzmw_, d2xzmx_, d2xzmy_, d2xzmz_ |